UniProtKB/Swiss-Prot PTM Description

Known to be C-mannosylated in the recombinant protein; it is not yet known for sure if the wild-type protein is also modified

Glycosylation Sites

Position Structures Description Evidence
W-319 Associated Structures: 1 global GlycoSuite
Site-Specific Information

A number of glycan structures have been assigned to specific glycosylation sites

Position Structures Description Evidence
TRP-319 Associated Structures: 1 Site specific GlycoSuite

Glycan Structures

Notes

Accompanying information sourced from GlycoSuiteDB

Sequence

MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

References 1

  1. Recombinant human interleukin-12 is the second example of a C-mannosylated protein.

    Doucey M, Hess D, Blommers M, Hofsteenge J

    PubMed: 10207176 Year: 1999