Integrated Proteomic and Glycoproteomic Analyses of Prostate Cancer Cells Reveal Glycoprotein Alteration in Protein Abundance and Glycosylation

Shah P, Wang X, Yang W, Toghi Eshghi S, Sun S, Hoti N, Chen L, Yang S, Pasay J, Rubin A, Zhang H

PubMed Entry: 26256267

Protein Hex HexNAc Fuc NeuNAc Peptide Category LnCap PC3
>gi|4504957|ref|NP_002285.1| lysosome-associated membrane glycoprotein 2 isoform A precursor [Homo sapiens] 3 2 0 0 AASTYSIDSVSFSYNTGDNTTFPDAEDK HM 0.99 0.3
>gi|4502897|ref|NP_001285.1| cleft lip and palate transmembrane protein 1 [Homo sapiens] 9 2 0 0 AEDYGPVEVISHWHPNITINIVDDHTPWVK HM 1.02 6.44
>gi|4502897|ref|NP_001285.1| cleft lip and palate transmembrane protein 1 [Homo sapiens] 9 2 0 0 AEDYGPVEVISHWHPNITINIVDDHTPWVK HM 0.95 21.39
>gi|4502897|ref|NP_001285.1| cleft lip and palate transmembrane protein 1 [Homo sapiens] 8 2 0 0 AEDYGPVEVISHWHPNITINIVDDHTPWVK HM 4.19 17.23
>gi|157266300|ref|NP_001141.2| aminopeptidase N precursor [Homo sapiens] 8 2 0 0 AEFNITLIHPK HM 1.04 0.84
>gi|157266300|ref|NP_001141.2| aminopeptidase N precursor [Homo sapiens] 8 2 0 0 AEFNITLIHPK HM 0.81 0.91
>gi|157266300|ref|NP_001141.2| aminopeptidase N precursor [Homo sapiens] 7 2 0 0 AEFNITLIHPK HM 1.37 9.6
>gi|157266300|ref|NP_001141.2| aminopeptidase N precursor [Homo sapiens] 7 2 0 0 AEFNITLIHPK HM 0.9 5.35
>gi|157266300|ref|NP_001141.2| aminopeptidase N precursor [Homo sapiens] 6 2 0 0 AEFNITLIHPK HM 1.11 1.15
>gi|157266300|ref|NP_001141.2| aminopeptidase N precursor [Homo sapiens] 6 3 0 1 AEFNITLIHPK S 1.0 1.69